PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G045600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family B3
Protein Properties Length: 359aa    MW: 39340.1 Da    PI: 9.218
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G045600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B335.12.3e-11401033299
                         --SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                  B3  32 esktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                         ++ t  + ++ g++W v+   ++ +g+ +l++GW eF+ a+g  +g f+v++++g  ++ l+vk+f++
  Brast09G045600.1.p  40 TQGTALVVNSFGKVWHVED--DRDGGGAFLGRGWPEFAAAQGFGVGWFLVLRHQG--RGVLTVKAFDT 103
                         3447888999*********..*******************************876..56669999986 PP

2B350.15.2e-161402211498
                         T-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                  B3  14 grlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                           + +p +f++ h  ++ ++s+t ++ ++ g+ W + l  +k++ +++l++GW++F   ng+ eg++v+F+++g+++f  ++kvf 
  Brast09G045600.1.p 140 EKMLIPAQFVQLHiPEVDQSSQTAVIVNPIGKFWCIGL--DKNGLGVLLAGGWSQFLAVNGISEGEVVLFRYEGNMTF--KIKVFG 221
                         3489******999966667899****************..**********************************9999..777775 PP

3B340.26.2e-132723391785
                         E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         +l  +f++++g ++++++tl+   +s + W+v+     k+ ry+ ++ W +F+++ng++egD+++F ++
  Brast09G045600.1.p 272 SLGLTFCDSIGFVEHCTITLKTSMKSTKCWQVRA-LGYKKYRYLTGEAWMSFCQENGIREGDVCTFNVV 339
                         67789********99998888888999******9.34444469999********************954 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508639.7981104IPR003340B3 DNA binding domain
SMARTSM010190.00174104IPR003340B3 DNA binding domain
CDDcd100171.87E-76102No hitNo description
Gene3DG3DSA:2.40.330.108.2E-116105IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.39E-116106IPR015300DNA-binding pseudobarrel domain
PfamPF023624.3E-915103IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.2E-19124225IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.71E-20125229IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.929127223IPR003340B3 DNA binding domain
CDDcd100175.59E-15128220No hitNo description
SMARTSM010191.1E-14130223IPR003340B3 DNA binding domain
PfamPF023628.0E-13139220IPR003340B3 DNA binding domain
SMARTSM010190.045240354IPR003340B3 DNA binding domain
PfamPF023623.6E-9272340IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.1E-12272350IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.28E-12273351IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.869288352IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009941Cellular Componentchloroplast envelope
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MAKQLKVLLP SSFEKMRISD ELAGHLVDAG NKSGAGPGMT QGTALVVNSF GKVWHVEDDR  60
DGGGAFLGRG WPEFAAAQGF GVGWFLVLRH QGRGVLTVKA FDTTFCLTES GLPPSAASRG  120
NRHSTRKPQF IKILLSCSME KMLIPAQFVQ LHIPEVDQSS QTAVIVNPIG KFWCIGLDKN  180
GLGVLLAGGW SQFLAVNGIS EGEVVLFRYE GNMTFKIKVF GHDGCQKDFR DQGTRVEQNT  240
EKKKEASSCS RKCKRKNEMS SGKQNGRPEG SSLGLTFCDS IGFVEHCTIT LKTSMKSTKC  300
WQVRALGYKK YRYLTGEAWM SFCQENGIRE GDVCTFNVVE TLLWHVVITR CSSSARTG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002447504.11e-121hypothetical protein SORBIDRAFT_06g002075, partial
RefseqXP_004977886.21e-120PREDICTED: putative B3 domain-containing protein Os04g0347400
SwissprotQ7XS751e-100Y4469_ORYSJ; Putative B3 domain-containing protein Os04g0346900
TrEMBLK3Y7G41e-121K3Y7G4_SETIT; Uncharacterized protein
STRINGSi010155m1e-121(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01580.13e-13B3 family protein